Placeholder image of a protein
Icon representing a puzzle

1792: Revisiting Puzzle 90: Heliomicin

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
January 27, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 8,950
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,541
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,508
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,381
  5. Avatar for Russian team 15. Russian team 1 pt. 8,236
  6. Avatar for Deleted group 17. Deleted group pts. 0

  1. Avatar for JackONeill12 111. JackONeill12 Lv 1 1 pt. 8,216
  2. Avatar for RootBeerSwordsman 112. RootBeerSwordsman Lv 1 1 pt. 8,214
  3. Avatar for muffnerk 113. muffnerk Lv 1 1 pt. 8,199
  4. Avatar for MartinKorinek 114. MartinKorinek Lv 1 1 pt. 8,179
  5. Avatar for Dantoto 115. Dantoto Lv 1 1 pt. 8,172
  6. Avatar for multaq 116. multaq Lv 1 1 pt. 8,151
  7. Avatar for thiagoxxxx 117. thiagoxxxx Lv 1 1 pt. 8,129
  8. Avatar for Philippe_C 118. Philippe_C Lv 1 1 pt. 8,128
  9. Avatar for Piovra79 119. Piovra79 Lv 1 1 pt. 8,054
  10. Avatar for pascal ochem 120. pascal ochem Lv 1 1 pt. 8,037

Comments