Placeholder image of a protein
Icon representing a puzzle

1792: Revisiting Puzzle 90: Heliomicin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
January 27, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 8,950
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,541
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,508
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,381
  5. Avatar for Russian team 15. Russian team 1 pt. 8,236
  6. Avatar for Bio 46 - Tufts University - Sp20 16. Bio 46 - Tufts University - Sp20 1 pt. 7,769
  7. Avatar for Deleted group 17. Deleted group pts. 0
  1. Avatar for allielynch 131. allielynch Lv 1 1 pt. 7,603
  2. Avatar for hildie 132. hildie Lv 1 1 pt. 7,523
  3. Avatar for TrashbinFR 133. TrashbinFR Lv 1 1 pt. 7,518
  4. Avatar for Puttering 134. Puttering Lv 1 1 pt. 7,511
  5. Avatar for joshmiller 135. joshmiller Lv 1 1 pt. 7,338
  6. Avatar for 01010011111 136. 01010011111 Lv 1 1 pt. 7,328
  7. Avatar for Tehnologik1 137. Tehnologik1 Lv 1 1 pt. 6,836
  8. Avatar for 1001kevin 138. 1001kevin Lv 1 1 pt. 6,261
  9. Avatar for bendy123456 139. bendy123456 Lv 1 1 pt. 4,620
  10. Avatar for cbwest 140. cbwest Lv 1 1 pt. 1,964

Comments