Placeholder image of a protein
Icon representing a puzzle

1792: Revisiting Puzzle 90: Heliomicin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
January 27, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 8,950
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,541
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,508
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,381
  5. Avatar for Russian team 15. Russian team 1 pt. 8,236
  6. Avatar for Bio 46 - Tufts University - Sp20 16. Bio 46 - Tufts University - Sp20 1 pt. 7,769
  7. Avatar for Deleted group 17. Deleted group pts. 0
  1. Avatar for Anfinsen_slept_here 31. Anfinsen_slept_here Lv 1 33 pts. 9,551
  2. Avatar for georg137 32. georg137 Lv 1 31 pts. 9,548
  3. Avatar for TastyMunchies 33. TastyMunchies Lv 1 30 pts. 9,544
  4. Avatar for MicElephant 34. MicElephant Lv 1 29 pts. 9,544
  5. Avatar for toshiue 35. toshiue Lv 1 28 pts. 9,526
  6. Avatar for Deleted player 36. Deleted player pts. 9,509
  7. Avatar for knotartist 37. knotartist Lv 1 25 pts. 9,504
  8. Avatar for WBarme1234 38. WBarme1234 Lv 1 24 pts. 9,484
  9. Avatar for CAN1958 39. CAN1958 Lv 1 23 pts. 9,473
  10. Avatar for Serca 40. Serca Lv 1 22 pts. 9,456

Comments