Placeholder image of a protein
Icon representing a puzzle

1792: Revisiting Puzzle 90: Heliomicin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
January 27, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 8,950
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,541
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,508
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,381
  5. Avatar for Russian team 15. Russian team 1 pt. 8,236
  6. Avatar for Bio 46 - Tufts University - Sp20 16. Bio 46 - Tufts University - Sp20 1 pt. 7,769
  7. Avatar for Deleted group 17. Deleted group pts. 0
  1. Avatar for bobcat 51. bobcat Lv 1 13 pts. 9,316
  2. Avatar for haabermaaster 52. haabermaaster Lv 1 13 pts. 9,262
  3. Avatar for jamiexq 53. jamiexq Lv 1 12 pts. 9,240
  4. Avatar for Idiotboy 54. Idiotboy Lv 1 11 pts. 9,216
  5. Avatar for alcor29 55. alcor29 Lv 1 11 pts. 9,209
  6. Avatar for Glen B 56. Glen B Lv 1 10 pts. 9,206
  7. Avatar for abiogenesis 57. abiogenesis Lv 1 10 pts. 9,144
  8. Avatar for ManVsYard 58. ManVsYard Lv 1 9 pts. 9,106
  9. Avatar for Pawel Tluscik 59. Pawel Tluscik Lv 1 9 pts. 9,096
  10. Avatar for Merf 60. Merf Lv 1 8 pts. 9,060

Comments