Placeholder image of a protein
Icon representing a puzzle

1801: Revisiting Puzzle 93: Spider Toxin

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
February 19, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 9,003
  2. Avatar for Deleted group 12. Deleted group pts. 8,647
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 8,309
  4. Avatar for OSSM FoldIt Team 14. OSSM FoldIt Team 1 pt. 7,307
  5. Avatar for Bio215_20 15. Bio215_20 1 pt. 7,105
  6. Avatar for Team New Zealand 16. Team New Zealand 1 pt. 6,587
  7. Avatar for Window Group 17. Window Group 1 pt. 5,343

  1. Avatar for PechA 101. PechA Lv 1 1 pt. 8,106
  2. Avatar for Deleted player 102. Deleted player pts. 8,049
  3. Avatar for brockstar113 103. brockstar113 Lv 1 1 pt. 8,041
  4. Avatar for pllq 104. pllq Lv 1 1 pt. 8,035
  5. Avatar for roman madala 105. roman madala Lv 1 1 pt. 8,016
  6. Avatar for Surakiet_Pitikarn 106. Surakiet_Pitikarn Lv 1 1 pt. 8,012
  7. Avatar for cobaltteal 107. cobaltteal Lv 1 1 pt. 7,976
  8. Avatar for smile_seasom 108. smile_seasom Lv 1 1 pt. 7,974
  9. Avatar for Anamfija 109. Anamfija Lv 1 1 pt. 7,945
  10. Avatar for pascal ochem 110. pascal ochem Lv 1 1 pt. 7,899

Comments