Placeholder image of a protein
Icon representing a puzzle

1807: Revisiting Puzzle 95: Chicken

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,270
  2. Avatar for CHNO Junkies 12. CHNO Junkies 1 pt. 9,871
  3. Avatar for xkcd 13. xkcd 1 pt. 9,831
  4. Avatar for Brony@Home 14. Brony@Home 1 pt. 9,802
  5. Avatar for Minions of TWIS 15. Minions of TWIS 1 pt. 9,782
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,458
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 9,213
  8. Avatar for ITAS Bocchialini - Parma 18. ITAS Bocchialini - Parma 1 pt. 8,966
  1. Avatar for lokivan 121. lokivan Lv 1 11 pts. 9,558
  2. Avatar for C583Tbw8b 122. C583Tbw8b Lv 1 11 pts. 9,557
  3. Avatar for foooooold 123. foooooold Lv 1 11 pts. 9,548
  4. Avatar for DScott 124. DScott Lv 1 11 pts. 9,533
  5. Avatar for chilifish 125. chilifish Lv 1 10 pts. 9,525
  6. Avatar for DrGibbs 126. DrGibbs Lv 1 10 pts. 9,525
  7. Avatar for antpiz 127. antpiz Lv 1 10 pts. 9,525
  8. Avatar for lucaeff 128. lucaeff Lv 1 10 pts. 9,524
  9. Avatar for Caopi 129. Caopi Lv 1 9 pts. 9,522
  10. Avatar for RockOn 130. RockOn Lv 1 9 pts. 9,493

Comments