Placeholder image of a protein
Icon representing a puzzle

1807: Revisiting Puzzle 95: Chicken

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,830
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,825
  3. Avatar for Go Science 3. Go Science 54 pts. 10,820
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 10,612
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,550
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 10,522
  7. Avatar for Contenders 7. Contenders 12 pts. 10,501
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,434
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,406
  10. Avatar for Hold My Beer 10. Hold My Beer 3 pts. 10,360
  1. Avatar for lokivan 121. lokivan Lv 1 11 pts. 9,558
  2. Avatar for C583Tbw8b 122. C583Tbw8b Lv 1 11 pts. 9,557
  3. Avatar for foooooold 123. foooooold Lv 1 11 pts. 9,548
  4. Avatar for DScott 124. DScott Lv 1 11 pts. 9,533
  5. Avatar for chilifish 125. chilifish Lv 1 10 pts. 9,525
  6. Avatar for DrGibbs 126. DrGibbs Lv 1 10 pts. 9,525
  7. Avatar for antpiz 127. antpiz Lv 1 10 pts. 9,525
  8. Avatar for lucaeff 128. lucaeff Lv 1 10 pts. 9,524
  9. Avatar for Caopi 129. Caopi Lv 1 9 pts. 9,522
  10. Avatar for RockOn 130. RockOn Lv 1 9 pts. 9,493

Comments