Placeholder image of a protein
Icon representing a puzzle

1807: Revisiting Puzzle 95: Chicken

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,270
  2. Avatar for CHNO Junkies 12. CHNO Junkies 1 pt. 9,871
  3. Avatar for xkcd 13. xkcd 1 pt. 9,831
  4. Avatar for Brony@Home 14. Brony@Home 1 pt. 9,802
  5. Avatar for Minions of TWIS 15. Minions of TWIS 1 pt. 9,782
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,458
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 9,213
  8. Avatar for ITAS Bocchialini - Parma 18. ITAS Bocchialini - Parma 1 pt. 8,966
  1. Avatar for christioanchauvin 21. christioanchauvin Lv 1 74 pts. 10,537
  2. Avatar for Blipperman 22. Blipperman Lv 1 73 pts. 10,522
  3. Avatar for jobo0502 23. jobo0502 Lv 1 72 pts. 10,516
  4. Avatar for crpainter 24. crpainter Lv 1 70 pts. 10,501
  5. Avatar for soulorcell 25. soulorcell Lv 1 69 pts. 10,495
  6. Avatar for Bruno Kestemont 26. Bruno Kestemont Lv 1 68 pts. 10,494
  7. Avatar for joremen 27. joremen Lv 1 67 pts. 10,475
  8. Avatar for katling 28. katling Lv 1 66 pts. 10,460
  9. Avatar for drumpeter18yrs9yrs 29. drumpeter18yrs9yrs Lv 1 65 pts. 10,458
  10. Avatar for Anfinsen_slept_here 30. Anfinsen_slept_here Lv 1 64 pts. 10,448

Comments