Placeholder image of a protein
Icon representing a puzzle

1807: Revisiting Puzzle 95: Chicken

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,830
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,825
  3. Avatar for Go Science 3. Go Science 54 pts. 10,820
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 10,612
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,550
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 10,522
  7. Avatar for Contenders 7. Contenders 12 pts. 10,501
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,434
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,406
  10. Avatar for Hold My Beer 10. Hold My Beer 3 pts. 10,360
  1. Avatar for christioanchauvin 21. christioanchauvin Lv 1 74 pts. 10,537
  2. Avatar for Blipperman 22. Blipperman Lv 1 73 pts. 10,522
  3. Avatar for jobo0502 23. jobo0502 Lv 1 72 pts. 10,516
  4. Avatar for crpainter 24. crpainter Lv 1 70 pts. 10,501
  5. Avatar for soulorcell 25. soulorcell Lv 1 69 pts. 10,495
  6. Avatar for Bruno Kestemont 26. Bruno Kestemont Lv 1 68 pts. 10,494
  7. Avatar for joremen 27. joremen Lv 1 67 pts. 10,475
  8. Avatar for katling 28. katling Lv 1 66 pts. 10,460
  9. Avatar for drumpeter18yrs9yrs 29. drumpeter18yrs9yrs Lv 1 65 pts. 10,458
  10. Avatar for Anfinsen_slept_here 30. Anfinsen_slept_here Lv 1 64 pts. 10,448

Comments