Placeholder image of a protein
Icon representing a puzzle

1807: Revisiting Puzzle 95: Chicken

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,270
  2. Avatar for CHNO Junkies 12. CHNO Junkies 1 pt. 9,871
  3. Avatar for xkcd 13. xkcd 1 pt. 9,831
  4. Avatar for Brony@Home 14. Brony@Home 1 pt. 9,802
  5. Avatar for Minions of TWIS 15. Minions of TWIS 1 pt. 9,782
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,458
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 9,213
  8. Avatar for ITAS Bocchialini - Parma 18. ITAS Bocchialini - Parma 1 pt. 8,966
  1. Avatar for oscarleong 291. oscarleong Lv 1 1 pt. 7,243
  2. Avatar for fernando1972 292. fernando1972 Lv 1 1 pt. 6,866
  3. Avatar for aerosols 293. aerosols Lv 1 1 pt. 6,528
  4. Avatar for Deleted player 294. Deleted player pts. 6,360
  5. Avatar for poormadman 295. poormadman Lv 1 1 pt. 6,329
  6. Avatar for jean jouannic 296. jean jouannic Lv 1 1 pt. 5,974
  7. Avatar for mert pur en erci 297. mert pur en erci Lv 1 1 pt. 5,908
  8. Avatar for t3l3m4chus 298. t3l3m4chus Lv 1 1 pt. 5,874
  9. Avatar for Nongchain 299. Nongchain Lv 1 1 pt. 5,648
  10. Avatar for ProxyNick 300. ProxyNick Lv 1 1 pt. 5,640

Comments