Placeholder image of a protein
Icon representing a puzzle

1807: Revisiting Puzzle 95: Chicken

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,830
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,825
  3. Avatar for Go Science 3. Go Science 54 pts. 10,820
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 10,612
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,550
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 10,522
  7. Avatar for Contenders 7. Contenders 12 pts. 10,501
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,434
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,406
  10. Avatar for Hold My Beer 10. Hold My Beer 3 pts. 10,360
  1. Avatar for oscarleong 291. oscarleong Lv 1 1 pt. 7,243
  2. Avatar for fernando1972 292. fernando1972 Lv 1 1 pt. 6,866
  3. Avatar for aerosols 293. aerosols Lv 1 1 pt. 6,528
  4. Avatar for Deleted player 294. Deleted player pts. 6,360
  5. Avatar for poormadman 295. poormadman Lv 1 1 pt. 6,329
  6. Avatar for jean jouannic 296. jean jouannic Lv 1 1 pt. 5,974
  7. Avatar for mert pur en erci 297. mert pur en erci Lv 1 1 pt. 5,908
  8. Avatar for t3l3m4chus 298. t3l3m4chus Lv 1 1 pt. 5,874
  9. Avatar for Nongchain 299. Nongchain Lv 1 1 pt. 5,648
  10. Avatar for ProxyNick 300. ProxyNick Lv 1 1 pt. 5,640

Comments