Placeholder image of a protein
Icon representing a puzzle

1807: Revisiting Puzzle 95: Chicken

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,270
  2. Avatar for CHNO Junkies 12. CHNO Junkies 1 pt. 9,871
  3. Avatar for xkcd 13. xkcd 1 pt. 9,831
  4. Avatar for Brony@Home 14. Brony@Home 1 pt. 9,802
  5. Avatar for Minions of TWIS 15. Minions of TWIS 1 pt. 9,782
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,458
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 9,213
  8. Avatar for ITAS Bocchialini - Parma 18. ITAS Bocchialini - Parma 1 pt. 8,966
  1. Avatar for Bletchley Park 321. Bletchley Park Lv 1 1 pt. 2,862
  2. Avatar for chiagiub96 322. chiagiub96 Lv 1 1 pt. 2,862
  3. Avatar for deme79 323. deme79 Lv 1 1 pt. 2,862
  4. Avatar for Pio_Pio_Pioter 324. Pio_Pio_Pioter Lv 1 1 pt. 2,862
  5. Avatar for nilma 325. nilma Lv 1 1 pt. 2,862
  6. Avatar for 01.esposito.mario 326. 01.esposito.mario Lv 1 1 pt. 2,862
  7. Avatar for Helmut1957 327. Helmut1957 Lv 1 1 pt. 2,862
  8. Avatar for Teecho 328. Teecho Lv 1 1 pt. 2,862
  9. Avatar for diego.chen 329. diego.chen Lv 1 1 pt. 2,862
  10. Avatar for ffedexs 330. ffedexs Lv 1 1 pt. 2,862

Comments