Placeholder image of a protein
Icon representing a puzzle

1807: Revisiting Puzzle 95: Chicken

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,830
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,825
  3. Avatar for Go Science 3. Go Science 54 pts. 10,820
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 10,612
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,550
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 10,522
  7. Avatar for Contenders 7. Contenders 12 pts. 10,501
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,434
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,406
  10. Avatar for Hold My Beer 10. Hold My Beer 3 pts. 10,360
  1. Avatar for Aussie_Guy 321. Aussie_Guy Lv 1 1 pt. 2,862
  2. Avatar for Gabotte 322. Gabotte Lv 1 1 pt. 2,862
  3. Avatar for Guardiao 323. Guardiao Lv 1 1 pt. 2,862
  4. Avatar for Vladimir000 324. Vladimir000 Lv 1 1 pt. 2,862
  5. Avatar for Dragonkiller 325. Dragonkiller Lv 1 1 pt. 2,862
  6. Avatar for Bletchley Park 326. Bletchley Park Lv 1 1 pt. 2,862
  7. Avatar for chiagiub96 327. chiagiub96 Lv 1 1 pt. 2,862
  8. Avatar for deme79 328. deme79 Lv 1 1 pt. 2,862
  9. Avatar for Pio_Pio_Pioter 329. Pio_Pio_Pioter Lv 1 1 pt. 2,862
  10. Avatar for 01.esposito.mario 330. 01.esposito.mario Lv 1 1 pt. 2,862

Comments