Placeholder image of a protein
Icon representing a puzzle

1807: Revisiting Puzzle 95: Chicken

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
March 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,270
  2. Avatar for CHNO Junkies 12. CHNO Junkies 1 pt. 9,871
  3. Avatar for xkcd 13. xkcd 1 pt. 9,831
  4. Avatar for Brony@Home 14. Brony@Home 1 pt. 9,802
  5. Avatar for Minions of TWIS 15. Minions of TWIS 1 pt. 9,782
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,458
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 9,213

  1. Avatar for diamonddays 41. diamonddays Lv 1 53 pts. 10,386
  2. Avatar for fiendish_ghoul 42. fiendish_ghoul Lv 1 52 pts. 10,378
  3. Avatar for Deleted player 43. Deleted player 52 pts. 10,361
  4. Avatar for Steven Pletsch 44. Steven Pletsch Lv 1 51 pts. 10,360
  5. Avatar for cbwest 45. cbwest Lv 1 50 pts. 10,347
  6. Avatar for Crossed Sticks 46. Crossed Sticks Lv 1 49 pts. 10,341
  7. Avatar for knotartist 47. knotartist Lv 1 48 pts. 10,322
  8. Avatar for Pikamander2 48. Pikamander2 Lv 1 47 pts. 10,314
  9. Avatar for Idiotboy 49. Idiotboy Lv 1 47 pts. 10,278
  10. Avatar for Keresto 50. Keresto Lv 1 46 pts. 10,275

Comments