Placeholder image of a protein
Icon representing a puzzle

1807: Revisiting Puzzle 95: Chicken

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,830
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,825
  3. Avatar for Go Science 3. Go Science 54 pts. 10,820
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 10,612
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,550
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 10,522
  7. Avatar for Contenders 7. Contenders 12 pts. 10,501
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,434
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,406
  10. Avatar for Hold My Beer 10. Hold My Beer 3 pts. 10,360
  1. Avatar for diamonddays 41. diamonddays Lv 1 53 pts. 10,386
  2. Avatar for fiendish_ghoul 42. fiendish_ghoul Lv 1 52 pts. 10,378
  3. Avatar for Deleted player 43. Deleted player 52 pts. 10,361
  4. Avatar for Steven Pletsch 44. Steven Pletsch Lv 1 51 pts. 10,360
  5. Avatar for cbwest 45. cbwest Lv 1 50 pts. 10,347
  6. Avatar for Crossed Sticks 46. Crossed Sticks Lv 1 49 pts. 10,341
  7. Avatar for knotartist 47. knotartist Lv 1 48 pts. 10,322
  8. Avatar for Pikamander2 48. Pikamander2 Lv 1 47 pts. 10,314
  9. Avatar for Idiotboy 49. Idiotboy Lv 1 47 pts. 10,278
  10. Avatar for Keresto 50. Keresto Lv 1 46 pts. 10,275

Comments