Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 10 pts. 10,137
  2. Avatar for Russian team 12. Russian team 8 pts. 10,096
  3. Avatar for Contenders 13. Contenders 6 pts. 10,075
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 4 pts. 10,064
  5. Avatar for Trinity Biology 15. Trinity Biology 3 pts. 10,005
  6. Avatar for Hold My Beer 16. Hold My Beer 2 pts. 9,975
  7. Avatar for CHNO Junkies 17. CHNO Junkies 2 pts. 9,936
  8. Avatar for BOINC@Poland 18. BOINC@Poland 1 pt. 9,709
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 9,670
  10. Avatar for Team India 20. Team India 1 pt. 9,663
  1. Avatar for fiendish_ghoul 11. fiendish_ghoul Lv 1 88 pts. 10,805
  2. Avatar for crpainter 12. crpainter Lv 1 87 pts. 10,804
  3. Avatar for robgee 13. robgee Lv 1 86 pts. 10,779
  4. Avatar for NinjaGreg 14. NinjaGreg Lv 1 84 pts. 10,773
  5. Avatar for mirp 15. mirp Lv 1 83 pts. 10,766
  6. Avatar for Phyx 16. Phyx Lv 1 82 pts. 10,765
  7. Avatar for johnmitch 17. johnmitch Lv 1 81 pts. 10,762
  8. Avatar for jobo0502 18. jobo0502 Lv 1 80 pts. 10,761
  9. Avatar for dcrwheeler 19. dcrwheeler Lv 1 79 pts. 10,751
  10. Avatar for joremen 20. joremen Lv 1 78 pts. 10,745

Comments