Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since about 6 years ago

Novice Novice Novice Novice Overall Overall Overall Overall Prediction Prediction Prediction Prediction

Summary


Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,074
  2. Avatar for Marvin's bunch 2. Marvin's bunch 83 pts. 11,052
  3. Avatar for Go Science 3. Go Science 69 pts. 11,043
  4. Avatar for Beta Folders 4. Beta Folders 56 pts. 11,030
  5. Avatar for Gargleblasters 5. Gargleblasters 45 pts. 10,895
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 36 pts. 10,761
  7. Avatar for HMT heritage 7. HMT heritage 29 pts. 10,544
  8. Avatar for Herobrine's Army 8. Herobrine's Army 23 pts. 10,469
  9. Avatar for Void Crushers 9. Void Crushers 18 pts. 10,292
  10. Avatar for SETI.Germany 10. SETI.Germany 14 pts. 10,288

  1. Avatar for fiendish_ghoul 11. fiendish_ghoul Lv 1 88 pts. 10,805
  2. Avatar for crpainter 12. crpainter Lv 1 87 pts. 10,804
  3. Avatar for robgee 13. robgee Lv 1 86 pts. 10,779
  4. Avatar for NinjaGreg 14. NinjaGreg Lv 1 84 pts. 10,773
  5. Avatar for mirp 15. mirp Lv 1 83 pts. 10,766
  6. Avatar for Phyx 16. Phyx Lv 1 82 pts. 10,765
  7. Avatar for johnmitch 17. johnmitch Lv 1 81 pts. 10,762
  8. Avatar for jobo0502 18. jobo0502 Lv 1 80 pts. 10,761
  9. Avatar for dcrwheeler 19. dcrwheeler Lv 1 79 pts. 10,751
  10. Avatar for joremen 20. joremen Lv 1 78 pts. 10,745

Comments