Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 10 pts. 10,137
  2. Avatar for Russian team 12. Russian team 8 pts. 10,096
  3. Avatar for Contenders 13. Contenders 6 pts. 10,075
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 4 pts. 10,064
  5. Avatar for Trinity Biology 15. Trinity Biology 3 pts. 10,005
  6. Avatar for Hold My Beer 16. Hold My Beer 2 pts. 9,975
  7. Avatar for CHNO Junkies 17. CHNO Junkies 2 pts. 9,936
  8. Avatar for BOINC@Poland 18. BOINC@Poland 1 pt. 9,709
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 9,670
  10. Avatar for Team India 20. Team India 1 pt. 9,663
  1. Avatar for hey24sheep 281. hey24sheep Lv 1 1 pt. 8,539
  2. Avatar for karmeitha 282. karmeitha Lv 1 1 pt. 8,511
  3. Avatar for ANU 283. ANU Lv 1 1 pt. 8,508
  4. Avatar for WHardy 284. WHardy Lv 1 1 pt. 8,506
  5. Avatar for Keijo Quuppa 285. Keijo Quuppa Lv 1 1 pt. 8,501
  6. Avatar for Ameghina 286. Ameghina Lv 1 1 pt. 8,500
  7. Avatar for Rin Kurogane 287. Rin Kurogane Lv 1 1 pt. 8,487
  8. Avatar for joseajerezv87 288. joseajerezv87 Lv 1 1 pt. 8,479
  9. Avatar for Suffer 289. Suffer Lv 1 1 pt. 8,459
  10. Avatar for peggyemmy 290. peggyemmy Lv 1 1 pt. 8,458

Comments