Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,074
  2. Avatar for Marvin's bunch 2. Marvin's bunch 83 pts. 11,052
  3. Avatar for Go Science 3. Go Science 69 pts. 11,043
  4. Avatar for Beta Folders 4. Beta Folders 56 pts. 11,030
  5. Avatar for Gargleblasters 5. Gargleblasters 45 pts. 10,895
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 36 pts. 10,761
  7. Avatar for HMT heritage 7. HMT heritage 29 pts. 10,544
  8. Avatar for Herobrine's Army 8. Herobrine's Army 23 pts. 10,469
  9. Avatar for Void Crushers 9. Void Crushers 18 pts. 10,292
  10. Avatar for SETI.Germany 10. SETI.Germany 14 pts. 10,288
  1. Avatar for hey24sheep 281. hey24sheep Lv 1 1 pt. 8,539
  2. Avatar for karmeitha 282. karmeitha Lv 1 1 pt. 8,511
  3. Avatar for ANU 283. ANU Lv 1 1 pt. 8,508
  4. Avatar for WHardy 284. WHardy Lv 1 1 pt. 8,506
  5. Avatar for Keijo Quuppa 285. Keijo Quuppa Lv 1 1 pt. 8,501
  6. Avatar for Ameghina 286. Ameghina Lv 1 1 pt. 8,500
  7. Avatar for Rin Kurogane 287. Rin Kurogane Lv 1 1 pt. 8,487
  8. Avatar for joseajerezv87 288. joseajerezv87 Lv 1 1 pt. 8,479
  9. Avatar for Suffer 289. Suffer Lv 1 1 pt. 8,459
  10. Avatar for peggyemmy 290. peggyemmy Lv 1 1 pt. 8,458

Comments