Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 10 pts. 10,137
  2. Avatar for Russian team 12. Russian team 8 pts. 10,096
  3. Avatar for Contenders 13. Contenders 6 pts. 10,075
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 4 pts. 10,064
  5. Avatar for Trinity Biology 15. Trinity Biology 3 pts. 10,005
  6. Avatar for Hold My Beer 16. Hold My Beer 2 pts. 9,975
  7. Avatar for CHNO Junkies 17. CHNO Junkies 2 pts. 9,936
  8. Avatar for BOINC@Poland 18. BOINC@Poland 1 pt. 9,709
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 9,670
  10. Avatar for Team India 20. Team India 1 pt. 9,663
  1. Avatar for Samyboy10 321. Samyboy10 Lv 1 1 pt. 8,003
  2. Avatar for FrankGrimes 322. FrankGrimes Lv 1 1 pt. 7,999
  3. Avatar for cbwest 323. cbwest Lv 1 1 pt. 7,996
  4. Avatar for Sakura85 324. Sakura85 Lv 1 1 pt. 7,953
  5. Avatar for Leonardo isaac 325. Leonardo isaac Lv 1 1 pt. 7,936
  6. Avatar for rollingtundarh 326. rollingtundarh Lv 1 1 pt. 7,932
  7. Avatar for yonathan1626 327. yonathan1626 Lv 1 1 pt. 7,896
  8. Avatar for Gnassar108 328. Gnassar108 Lv 1 1 pt. 7,889
  9. Avatar for 01010011111 329. 01010011111 Lv 1 1 pt. 7,856
  10. Avatar for Giliabo 330. Giliabo Lv 1 1 pt. 7,807

Comments