Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,074
  2. Avatar for Marvin's bunch 2. Marvin's bunch 83 pts. 11,052
  3. Avatar for Go Science 3. Go Science 69 pts. 11,043
  4. Avatar for Beta Folders 4. Beta Folders 56 pts. 11,030
  5. Avatar for Gargleblasters 5. Gargleblasters 45 pts. 10,895
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 36 pts. 10,761
  7. Avatar for HMT heritage 7. HMT heritage 29 pts. 10,544
  8. Avatar for Herobrine's Army 8. Herobrine's Army 23 pts. 10,469
  9. Avatar for Void Crushers 9. Void Crushers 18 pts. 10,292
  10. Avatar for SETI.Germany 10. SETI.Germany 14 pts. 10,288
  1. Avatar for Samyboy10 321. Samyboy10 Lv 1 1 pt. 8,003
  2. Avatar for FrankGrimes 322. FrankGrimes Lv 1 1 pt. 7,999
  3. Avatar for cbwest 323. cbwest Lv 1 1 pt. 7,996
  4. Avatar for Sakura85 324. Sakura85 Lv 1 1 pt. 7,953
  5. Avatar for Leonardo isaac 325. Leonardo isaac Lv 1 1 pt. 7,936
  6. Avatar for rollingtundarh 326. rollingtundarh Lv 1 1 pt. 7,932
  7. Avatar for yonathan1626 327. yonathan1626 Lv 1 1 pt. 7,896
  8. Avatar for Gnassar108 328. Gnassar108 Lv 1 1 pt. 7,889
  9. Avatar for 01010011111 329. 01010011111 Lv 1 1 pt. 7,856
  10. Avatar for Giliabo 330. Giliabo Lv 1 1 pt. 7,807

Comments