Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 10 pts. 10,137
  2. Avatar for Russian team 12. Russian team 8 pts. 10,096
  3. Avatar for Contenders 13. Contenders 6 pts. 10,075
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 4 pts. 10,064
  5. Avatar for Trinity Biology 15. Trinity Biology 3 pts. 10,005
  6. Avatar for Hold My Beer 16. Hold My Beer 2 pts. 9,975
  7. Avatar for CHNO Junkies 17. CHNO Junkies 2 pts. 9,936
  8. Avatar for BOINC@Poland 18. BOINC@Poland 1 pt. 9,709
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 9,670
  10. Avatar for Team India 20. Team India 1 pt. 9,663
  1. Avatar for Spidersling 71. Spidersling Lv 1 37 pts. 10,056
  2. Avatar for Merf 72. Merf Lv 1 36 pts. 10,050
  3. Avatar for RyeSnake 73. RyeSnake Lv 1 35 pts. 10,038
  4. Avatar for DodoBird 74. DodoBird Lv 1 35 pts. 10,033
  5. Avatar for alyssa_d_V2.0 75. alyssa_d_V2.0 Lv 1 34 pts. 10,005
  6. Avatar for Hellcat6 76. Hellcat6 Lv 1 34 pts. 9,984
  7. Avatar for Steven Pletsch 77. Steven Pletsch Lv 1 33 pts. 9,975
  8. Avatar for MrZanav 78. MrZanav Lv 1 33 pts. 9,966
  9. Avatar for georg137 79. georg137 Lv 1 32 pts. 9,964
  10. Avatar for PuzzlingIKnow 80. PuzzlingIKnow Lv 1 32 pts. 9,948

Comments