Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,074
  2. Avatar for Marvin's bunch 2. Marvin's bunch 83 pts. 11,052
  3. Avatar for Go Science 3. Go Science 69 pts. 11,043
  4. Avatar for Beta Folders 4. Beta Folders 56 pts. 11,030
  5. Avatar for Gargleblasters 5. Gargleblasters 45 pts. 10,895
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 36 pts. 10,761
  7. Avatar for HMT heritage 7. HMT heritage 29 pts. 10,544
  8. Avatar for Herobrine's Army 8. Herobrine's Army 23 pts. 10,469
  9. Avatar for Void Crushers 9. Void Crushers 18 pts. 10,292
  10. Avatar for SETI.Germany 10. SETI.Germany 14 pts. 10,288
  1. Avatar for Spidersling 71. Spidersling Lv 1 37 pts. 10,056
  2. Avatar for Merf 72. Merf Lv 1 36 pts. 10,050
  3. Avatar for RyeSnake 73. RyeSnake Lv 1 35 pts. 10,038
  4. Avatar for DodoBird 74. DodoBird Lv 1 35 pts. 10,033
  5. Avatar for alyssa_d_V2.0 75. alyssa_d_V2.0 Lv 1 34 pts. 10,005
  6. Avatar for Hellcat6 76. Hellcat6 Lv 1 34 pts. 9,984
  7. Avatar for Steven Pletsch 77. Steven Pletsch Lv 1 33 pts. 9,975
  8. Avatar for MrZanav 78. MrZanav Lv 1 33 pts. 9,966
  9. Avatar for georg137 79. georg137 Lv 1 32 pts. 9,964
  10. Avatar for PuzzlingIKnow 80. PuzzlingIKnow Lv 1 32 pts. 9,948

Comments