Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for Minions of TWIS 21. Minions of TWIS 1 pt. 9,406
  2. Avatar for Team China 22. Team China 1 pt. 8,906
  3. Avatar for Deleted group 23. Deleted group pts. 8,781
  4. Avatar for Coastal Biochemistry 24. Coastal Biochemistry 1 pt. 8,694
  5. Avatar for Penny-Arcade 25. Penny-Arcade 1 pt. 8,691
  6. Avatar for ITESO2017O 26. ITESO2017O 1 pt. 8,087
  7. Avatar for BIOL 4030 Winter 2020 27. BIOL 4030 Winter 2020 1 pt. 6,190
  8. Avatar for foldeRNA 28. foldeRNA 1 pt. 5,467

  1. Avatar for Dolichwier 111. Dolichwier Lv 1 19 pts. 9,556
  2. Avatar for Ethan Leopold 112. Ethan Leopold Lv 1 18 pts. 9,550
  3. Avatar for pfirth 113. pfirth Lv 1 18 pts. 9,549
  4. Avatar for micon 114. micon Lv 1 18 pts. 9,537
  5. Avatar for allie_heather47 115. allie_heather47 Lv 1 17 pts. 9,532
  6. Avatar for dahast.de 116. dahast.de Lv 1 17 pts. 9,532
  7. Avatar for hajtogato 117. hajtogato Lv 1 17 pts. 9,515
  8. Avatar for Mike Cassidy 118. Mike Cassidy Lv 1 16 pts. 9,507
  9. Avatar for aeonium 119. aeonium Lv 1 16 pts. 9,489
  10. Avatar for Pikamander2 120. Pikamander2 Lv 1 16 pts. 9,486

Comments