Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Minions of TWIS 21. Minions of TWIS 1 pt. 9,406
  2. Avatar for Team China 22. Team China 1 pt. 8,906
  3. Avatar for Deleted group 23. Deleted group pts. 8,781
  4. Avatar for Coastal Biochemistry 24. Coastal Biochemistry 1 pt. 8,694
  5. Avatar for Penny-Arcade 25. Penny-Arcade 1 pt. 8,691
  6. Avatar for ITESO2017O 26. ITESO2017O 1 pt. 8,087
  7. Avatar for BIOL 4030 Winter 2020 27. BIOL 4030 Winter 2020 1 pt. 6,190
  8. Avatar for foldeRNA 28. foldeRNA 1 pt. 5,467
  1. Avatar for lconor 121. lconor Lv 1 15 pts. 9,482
  2. Avatar for Trajan464 122. Trajan464 Lv 1 15 pts. 9,471
  3. Avatar for GuR0 123. GuR0 Lv 1 15 pts. 9,462
  4. Avatar for wolF777 124. wolF777 Lv 1 15 pts. 9,447
  5. Avatar for Deleted player 125. Deleted player pts. 9,444
  6. Avatar for SKSbell 126. SKSbell Lv 1 14 pts. 9,419
  7. Avatar for pente_player 127. pente_player Lv 1 14 pts. 9,412
  8. Avatar for gldisater 128. gldisater Lv 1 13 pts. 9,406
  9. Avatar for JoaThePet 129. JoaThePet Lv 1 13 pts. 9,397
  10. Avatar for Deleted player 130. Deleted player pts. 9,395

Comments