Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Minions of TWIS 21. Minions of TWIS 1 pt. 9,406
  2. Avatar for Team China 22. Team China 1 pt. 8,906
  3. Avatar for Deleted group 23. Deleted group pts. 8,781
  4. Avatar for Coastal Biochemistry 24. Coastal Biochemistry 1 pt. 8,694
  5. Avatar for Penny-Arcade 25. Penny-Arcade 1 pt. 8,691
  6. Avatar for ITESO2017O 26. ITESO2017O 1 pt. 8,087
  7. Avatar for BIOL 4030 Winter 2020 27. BIOL 4030 Winter 2020 1 pt. 6,190
  8. Avatar for foldeRNA 28. foldeRNA 1 pt. 5,467
  1. Avatar for Vd196692 181. Vd196692 Lv 1 4 pts. 8,892
  2. Avatar for keithv 182. keithv Lv 1 4 pts. 8,888
  3. Avatar for daveghume 183. daveghume Lv 1 4 pts. 8,885
  4. Avatar for joshfb 184. joshfb Lv 1 4 pts. 8,864
  5. Avatar for Philie89 185. Philie89 Lv 1 4 pts. 8,847
  6. Avatar for pingas as usual 186. pingas as usual Lv 1 4 pts. 8,839
  7. Avatar for argyrw 187. argyrw Lv 1 4 pts. 8,833
  8. Avatar for kail 188. kail Lv 1 4 pts. 8,832
  9. Avatar for marp 189. marp Lv 1 4 pts. 8,832
  10. Avatar for Carall 190. Carall Lv 1 4 pts. 8,831

Comments