Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Minions of TWIS 21. Minions of TWIS 1 pt. 9,406
  2. Avatar for Team China 22. Team China 1 pt. 8,906
  3. Avatar for Deleted group 23. Deleted group pts. 8,781
  4. Avatar for Coastal Biochemistry 24. Coastal Biochemistry 1 pt. 8,694
  5. Avatar for Penny-Arcade 25. Penny-Arcade 1 pt. 8,691
  6. Avatar for ITESO2017O 26. ITESO2017O 1 pt. 8,087
  7. Avatar for BIOL 4030 Winter 2020 27. BIOL 4030 Winter 2020 1 pt. 6,190
  8. Avatar for foldeRNA 28. foldeRNA 1 pt. 5,467
  1. Avatar for xyzzyx13 271. xyzzyx13 Lv 1 1 pt. 8,579
  2. Avatar for PolderDeichkind 272. PolderDeichkind Lv 1 1 pt. 8,568
  3. Avatar for angazit 273. angazit Lv 1 1 pt. 8,563
  4. Avatar for Maniaq 274. Maniaq Lv 1 1 pt. 8,562
  5. Avatar for zerbi2020 275. zerbi2020 Lv 1 1 pt. 8,556
  6. Avatar for addict666 276. addict666 Lv 1 1 pt. 8,547
  7. Avatar for nebu84 277. nebu84 Lv 1 1 pt. 8,546
  8. Avatar for kevin everington 278. kevin everington Lv 1 1 pt. 8,543
  9. Avatar for Akida 279. Akida Lv 1 1 pt. 8,543
  10. Avatar for Jonah2020 280. Jonah2020 Lv 1 1 pt. 8,540

Comments