Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Minions of TWIS 21. Minions of TWIS 1 pt. 9,406
  2. Avatar for Team China 22. Team China 1 pt. 8,906
  3. Avatar for Deleted group 23. Deleted group pts. 8,781
  4. Avatar for Coastal Biochemistry 24. Coastal Biochemistry 1 pt. 8,694
  5. Avatar for Penny-Arcade 25. Penny-Arcade 1 pt. 8,691
  6. Avatar for ITESO2017O 26. ITESO2017O 1 pt. 8,087
  7. Avatar for BIOL 4030 Winter 2020 27. BIOL 4030 Winter 2020 1 pt. 6,190
  8. Avatar for foldeRNA 28. foldeRNA 1 pt. 5,467
  1. Avatar for Sqrwiel 291. Sqrwiel Lv 1 1 pt. 8,457
  2. Avatar for EosSwiss 292. EosSwiss Lv 1 1 pt. 8,453
  3. Avatar for uskoma 293. uskoma Lv 1 1 pt. 8,437
  4. Avatar for Guillaume628 294. Guillaume628 Lv 1 1 pt. 8,427
  5. Avatar for Die 295. Die Lv 1 1 pt. 8,426
  6. Avatar for lego_user 296. lego_user Lv 1 1 pt. 8,420
  7. Avatar for HMK 297. HMK Lv 1 1 pt. 8,416
  8. Avatar for Dima_8002 298. Dima_8002 Lv 1 1 pt. 8,405
  9. Avatar for masterchief8080 299. masterchief8080 Lv 1 1 pt. 8,399
  10. Avatar for creepen 300. creepen Lv 1 1 pt. 8,390

Comments