Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since about 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Minions of TWIS 21. Minions of TWIS 1 pt. 9,406
  2. Avatar for Team China 22. Team China 1 pt. 8,906
  3. Avatar for Deleted group 23. Deleted group pts. 8,781
  4. Avatar for Coastal Biochemistry 24. Coastal Biochemistry 1 pt. 8,694
  5. Avatar for Penny-Arcade 25. Penny-Arcade 1 pt. 8,691
  6. Avatar for ITESO2017O 26. ITESO2017O 1 pt. 8,087
  7. Avatar for BIOL 4030 Winter 2020 27. BIOL 4030 Winter 2020 1 pt. 6,190
  8. Avatar for foldeRNA 28. foldeRNA 1 pt. 5,467
  1. Avatar for Wolfs Hollow 311. Wolfs Hollow Lv 1 1 pt. 8,088
  2. Avatar for searchlight 312. searchlight Lv 1 1 pt. 8,088
  3. Avatar for Mellert199 313. Mellert199 Lv 1 1 pt. 8,088
  4. Avatar for sissy 314. sissy Lv 1 1 pt. 8,087
  5. Avatar for FeatHiqhlife 315. FeatHiqhlife Lv 1 1 pt. 8,087
  6. Avatar for Cristobal-FBC 316. Cristobal-FBC Lv 1 1 pt. 8,087
  7. Avatar for Johan Klein Entink 317. Johan Klein Entink Lv 1 1 pt. 8,062
  8. Avatar for bhirsch 318. bhirsch Lv 1 1 pt. 8,055
  9. Avatar for Shogo 319. Shogo Lv 1 1 pt. 8,018
  10. Avatar for gizmodu 320. gizmodu Lv 1 1 pt. 8,011

Comments