Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Minions of TWIS 21. Minions of TWIS 1 pt. 9,406
  2. Avatar for Team China 22. Team China 1 pt. 8,906
  3. Avatar for Deleted group 23. Deleted group pts. 8,781
  4. Avatar for Coastal Biochemistry 24. Coastal Biochemistry 1 pt. 8,694
  5. Avatar for Penny-Arcade 25. Penny-Arcade 1 pt. 8,691
  6. Avatar for ITESO2017O 26. ITESO2017O 1 pt. 8,087
  7. Avatar for BIOL 4030 Winter 2020 27. BIOL 4030 Winter 2020 1 pt. 6,190
  8. Avatar for foldeRNA 28. foldeRNA 1 pt. 5,467
  1. Avatar for roby1957 351. roby1957 Lv 1 1 pt. 5,895
  2. Avatar for wave420 352. wave420 Lv 1 1 pt. 5,874
  3. Avatar for haldun 353. haldun Lv 1 1 pt. 5,841
  4. Avatar for jani3009 354. jani3009 Lv 1 1 pt. 5,828
  5. Avatar for jonasheinrich 355. jonasheinrich Lv 1 1 pt. 5,604
  6. Avatar for Karadus 356. Karadus Lv 1 1 pt. 5,591
  7. Avatar for MaryJane97 357. MaryJane97 Lv 1 1 pt. 5,516
  8. Avatar for dankofscotland 358. dankofscotland Lv 1 1 pt. 5,467
  9. Avatar for JustinHBaier 359. JustinHBaier Lv 1 1 pt. 5,467
  10. Avatar for zohon 360. zohon Lv 1 1 pt. 5,467

Comments