Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since about 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Minions of TWIS 21. Minions of TWIS 1 pt. 9,406
  2. Avatar for Team China 22. Team China 1 pt. 8,906
  3. Avatar for Deleted group 23. Deleted group pts. 8,781
  4. Avatar for Coastal Biochemistry 24. Coastal Biochemistry 1 pt. 8,694
  5. Avatar for Penny-Arcade 25. Penny-Arcade 1 pt. 8,691
  6. Avatar for ITESO2017O 26. ITESO2017O 1 pt. 8,087
  7. Avatar for BIOL 4030 Winter 2020 27. BIOL 4030 Winter 2020 1 pt. 6,190
  8. Avatar for foldeRNA 28. foldeRNA 1 pt. 5,467
  1. Avatar for SWR_DMaster 31. SWR_DMaster Lv 1 67 pts. 10,572
  2. Avatar for Anfinsen_slept_here 32. Anfinsen_slept_here Lv 1 66 pts. 10,572
  3. Avatar for O Seki To 33. O Seki To Lv 1 65 pts. 10,544
  4. Avatar for Satina 34. Satina Lv 1 64 pts. 10,540
  5. Avatar for Glen B 35. Glen B Lv 1 63 pts. 10,508
  6. Avatar for WBarme1234 36. WBarme1234 Lv 1 62 pts. 10,498
  7. Avatar for jausmh 37. jausmh Lv 1 61 pts. 10,484
  8. Avatar for alwen 38. alwen Lv 1 60 pts. 10,481
  9. Avatar for Deleted player 39. Deleted player 59 pts. 10,476
  10. Avatar for HerobrinesArmy 40. HerobrinesArmy Lv 1 59 pts. 10,469

Comments