Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Minions of TWIS 21. Minions of TWIS 1 pt. 9,406
  2. Avatar for Team China 22. Team China 1 pt. 8,906
  3. Avatar for Deleted group 23. Deleted group pts. 8,781
  4. Avatar for Coastal Biochemistry 24. Coastal Biochemistry 1 pt. 8,694
  5. Avatar for Penny-Arcade 25. Penny-Arcade 1 pt. 8,691
  6. Avatar for ITESO2017O 26. ITESO2017O 1 pt. 8,087
  7. Avatar for BIOL 4030 Winter 2020 27. BIOL 4030 Winter 2020 1 pt. 6,190
  8. Avatar for foldeRNA 28. foldeRNA 1 pt. 5,467
  1. Avatar for pmlkjn 81. pmlkjn Lv 1 31 pts. 9,936
  2. Avatar for Barium56 82. Barium56 Lv 1 31 pts. 9,934
  3. Avatar for donuts554 83. donuts554 Lv 1 30 pts. 9,934
  4. Avatar for kathy65 84. kathy65 Lv 1 30 pts. 9,924
  5. Avatar for harvardman 85. harvardman Lv 1 29 pts. 9,916
  6. Avatar for TheGUmmer 86. TheGUmmer Lv 1 29 pts. 9,906
  7. Avatar for fearjuan 87. fearjuan Lv 1 28 pts. 9,904
  8. Avatar for Tygh 88. Tygh Lv 1 28 pts. 9,890
  9. Avatar for hansvandenhof 89. hansvandenhof Lv 1 27 pts. 9,865
  10. Avatar for cryptoriddler 90. cryptoriddler Lv 1 27 pts. 9,825

Comments