Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,074
  2. Avatar for Marvin's bunch 2. Marvin's bunch 83 pts. 11,052
  3. Avatar for Go Science 3. Go Science 69 pts. 11,043
  4. Avatar for Beta Folders 4. Beta Folders 56 pts. 11,030
  5. Avatar for Gargleblasters 5. Gargleblasters 45 pts. 10,895
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 36 pts. 10,761
  7. Avatar for HMT heritage 7. HMT heritage 29 pts. 10,544
  8. Avatar for Herobrine's Army 8. Herobrine's Army 23 pts. 10,469
  9. Avatar for Void Crushers 9. Void Crushers 18 pts. 10,292
  10. Avatar for SETI.Germany 10. SETI.Germany 14 pts. 10,288
  1. Avatar for Blipperman 21. Blipperman Lv 1 77 pts. 10,688
  2. Avatar for aznarog 22. aznarog Lv 1 76 pts. 10,682
  3. Avatar for silent gene 23. silent gene Lv 1 75 pts. 10,674
  4. Avatar for Threeoak 24. Threeoak Lv 1 74 pts. 10,646
  5. Avatar for Scopper 25. Scopper Lv 1 73 pts. 10,644
  6. Avatar for phi16 26. phi16 Lv 1 72 pts. 10,632
  7. Avatar for TastyMunchies 27. TastyMunchies Lv 1 71 pts. 10,630
  8. Avatar for Deet 28. Deet Lv 1 70 pts. 10,624
  9. Avatar for christioanchauvin 29. christioanchauvin Lv 1 69 pts. 10,598
  10. Avatar for Deleted player 30. Deleted player pts. 10,593

Comments