Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,074
  2. Avatar for Marvin's bunch 2. Marvin's bunch 83 pts. 11,052
  3. Avatar for Go Science 3. Go Science 69 pts. 11,043
  4. Avatar for Beta Folders 4. Beta Folders 56 pts. 11,030
  5. Avatar for Gargleblasters 5. Gargleblasters 45 pts. 10,895
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 36 pts. 10,761
  7. Avatar for HMT heritage 7. HMT heritage 29 pts. 10,544
  8. Avatar for Herobrine's Army 8. Herobrine's Army 23 pts. 10,469
  9. Avatar for Void Crushers 9. Void Crushers 18 pts. 10,292
  10. Avatar for SETI.Germany 10. SETI.Germany 14 pts. 10,288
  1. Avatar for ofey3 211. ofey3 Lv 1 2 pts. 8,764
  2. Avatar for weiter 212. weiter Lv 1 2 pts. 8,764
  3. Avatar for Nyghtus 213. Nyghtus Lv 1 2 pts. 8,752
  4. Avatar for amsat 214. amsat Lv 1 2 pts. 8,740
  5. Avatar for multaq 215. multaq Lv 1 2 pts. 8,735
  6. Avatar for ckc 216. ckc Lv 1 2 pts. 8,734
  7. Avatar for hongthaituha2 217. hongthaituha2 Lv 1 2 pts. 8,733
  8. Avatar for kingofking 218. kingofking Lv 1 2 pts. 8,730
  9. Avatar for jawz101 219. jawz101 Lv 1 2 pts. 8,730
  10. Avatar for Fexel 220. Fexel Lv 1 2 pts. 8,729

Comments