Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,074
  2. Avatar for Marvin's bunch 2. Marvin's bunch 83 pts. 11,052
  3. Avatar for Go Science 3. Go Science 69 pts. 11,043
  4. Avatar for Beta Folders 4. Beta Folders 56 pts. 11,030
  5. Avatar for Gargleblasters 5. Gargleblasters 45 pts. 10,895
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 36 pts. 10,761
  7. Avatar for HMT heritage 7. HMT heritage 29 pts. 10,544
  8. Avatar for Herobrine's Army 8. Herobrine's Army 23 pts. 10,469
  9. Avatar for Void Crushers 9. Void Crushers 18 pts. 10,292
  10. Avatar for SETI.Germany 10. SETI.Germany 14 pts. 10,288
  1. Avatar for Daodunu 251. Daodunu Lv 1 1 pt. 8,664
  2. Avatar for alienx 252. alienx Lv 1 1 pt. 8,659
  3. Avatar for BigDennis 253. BigDennis Lv 1 1 pt. 8,653
  4. Avatar for WoutSCC 254. WoutSCC Lv 1 1 pt. 8,647
  5. Avatar for Mickataef 255. Mickataef Lv 1 1 pt. 8,646
  6. Avatar for Knuspy 256. Knuspy Lv 1 1 pt. 8,644
  7. Avatar for YellowBearPL 257. YellowBearPL Lv 1 1 pt. 8,642
  8. Avatar for rizkyh.m 258. rizkyh.m Lv 1 1 pt. 8,640
  9. Avatar for yunifay 259. yunifay Lv 1 1 pt. 8,640
  10. Avatar for Mahalippi 260. Mahalippi Lv 1 1 pt. 8,639

Comments