Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,074
  2. Avatar for Marvin's bunch 2. Marvin's bunch 83 pts. 11,052
  3. Avatar for Go Science 3. Go Science 69 pts. 11,043
  4. Avatar for Beta Folders 4. Beta Folders 56 pts. 11,030
  5. Avatar for Gargleblasters 5. Gargleblasters 45 pts. 10,895
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 36 pts. 10,761
  7. Avatar for HMT heritage 7. HMT heritage 29 pts. 10,544
  8. Avatar for Herobrine's Army 8. Herobrine's Army 23 pts. 10,469
  9. Avatar for Void Crushers 9. Void Crushers 18 pts. 10,292
  10. Avatar for SETI.Germany 10. SETI.Germany 14 pts. 10,288
  1. Avatar for DerFalk 331. DerFalk Lv 1 1 pt. 7,634
  2. Avatar for John McLeod 332. John McLeod Lv 1 1 pt. 7,618
  3. Avatar for VNHLT 333. VNHLT Lv 1 1 pt. 7,455
  4. Avatar for miya_ta98 334. miya_ta98 Lv 1 1 pt. 7,379
  5. Avatar for DmxKuu 335. DmxKuu Lv 1 1 pt. 7,284
  6. Avatar for AimeeNjeri 336. AimeeNjeri Lv 1 1 pt. 7,136
  7. Avatar for Wolverine12822 337. Wolverine12822 Lv 1 1 pt. 7,115
  8. Avatar for juani2468 338. juani2468 Lv 1 1 pt. 6,596
  9. Avatar for YU91 339. YU91 Lv 1 1 pt. 6,578
  10. Avatar for Marcel2712 340. Marcel2712 Lv 1 1 pt. 6,485

Comments