Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,074
  2. Avatar for Marvin's bunch 2. Marvin's bunch 83 pts. 11,052
  3. Avatar for Go Science 3. Go Science 69 pts. 11,043
  4. Avatar for Beta Folders 4. Beta Folders 56 pts. 11,030
  5. Avatar for Gargleblasters 5. Gargleblasters 45 pts. 10,895
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 36 pts. 10,761
  7. Avatar for HMT heritage 7. HMT heritage 29 pts. 10,544
  8. Avatar for Herobrine's Army 8. Herobrine's Army 23 pts. 10,469
  9. Avatar for Void Crushers 9. Void Crushers 18 pts. 10,292
  10. Avatar for SETI.Germany 10. SETI.Germany 14 pts. 10,288
  1. Avatar for Ikuso 61. Ikuso Lv 1 43 pts. 10,137
  2. Avatar for CAN1958 62. CAN1958 Lv 1 42 pts. 10,128
  3. Avatar for drumpeter18yrs9yrs 63. drumpeter18yrs9yrs Lv 1 41 pts. 10,102
  4. Avatar for Arne Heessels 64. Arne Heessels Lv 1 41 pts. 10,101
  5. Avatar for Biochemica 65. Biochemica Lv 1 40 pts. 10,101
  6. Avatar for ComputerMage 66. ComputerMage Lv 1 40 pts. 10,096
  7. Avatar for ManVsYard 67. ManVsYard Lv 1 39 pts. 10,095
  8. Avatar for infjamc 68. infjamc Lv 1 38 pts. 10,075
  9. Avatar for pmthomson90 69. pmthomson90 Lv 1 38 pts. 10,064
  10. Avatar for Pawel Tluscik 70. Pawel Tluscik Lv 1 37 pts. 10,058

Comments