Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 6 pts. 8,989
  2. Avatar for Marvin's bunch 12. Marvin's bunch 4 pts. 8,984
  3. Avatar for Herobrine's Army 13. Herobrine's Army 3 pts. 8,977
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,960
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 8,911
  6. Avatar for Penny-Arcade 16. Penny-Arcade 1 pt. 8,766
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 8,693
  8. Avatar for Russian team 19. Russian team 1 pt. 8,535
  9. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 8,465

  1. Avatar for TECHFREAK 21. TECHFREAK Lv 1 80 pts. 9,055
  2. Avatar for christioanchauvin 22. christioanchauvin Lv 1 79 pts. 9,027
  3. Avatar for Blipperman 23. Blipperman Lv 1 79 pts. 9,025
  4. Avatar for georg137 24. georg137 Lv 1 78 pts. 9,024
  5. Avatar for joremen 25. joremen Lv 1 77 pts. 9,023
  6. Avatar for nicobul 26. nicobul Lv 1 76 pts. 9,017
  7. Avatar for Anfinsen_slept_here 27. Anfinsen_slept_here Lv 1 75 pts. 9,017
  8. Avatar for Xartos 28. Xartos Lv 1 74 pts. 9,015
  9. Avatar for aznarog 29. aznarog Lv 1 73 pts. 9,008
  10. Avatar for spdenne 30. spdenne Lv 1 72 pts. 9,001

Comments