Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 6 pts. 8,989
  2. Avatar for Marvin's bunch 12. Marvin's bunch 4 pts. 8,984
  3. Avatar for Herobrine's Army 13. Herobrine's Army 3 pts. 8,977
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,960
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 8,911
  6. Avatar for Penny-Arcade 16. Penny-Arcade 1 pt. 8,766
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 8,693
  8. Avatar for Richard Dawkins Foundation 18. Richard Dawkins Foundation 1 pt. 8,608
  9. Avatar for Russian team 19. Russian team 1 pt. 8,535
  10. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 8,465
  1. Avatar for Ricmondka6 391. Ricmondka6 Lv 1 1 pt. 7,575
  2. Avatar for AKTS_Tony 392. AKTS_Tony Lv 1 1 pt. 7,538
  3. Avatar for Saskia1408 393. Saskia1408 Lv 1 1 pt. 7,530
  4. Avatar for Tim_1717 394. Tim_1717 Lv 1 1 pt. 7,517
  5. Avatar for Gianfranco72 395. Gianfranco72 Lv 1 1 pt. 7,478
  6. Avatar for Bioxandr 396. Bioxandr Lv 1 1 pt. 7,136
  7. Avatar for Bogert 397. Bogert Lv 1 1 pt. 6,579
  8. Avatar for Lars45 398. Lars45 Lv 1 1 pt. 6,506
  9. Avatar for hieu15 399. hieu15 Lv 1 1 pt. 6,493
  10. Avatar for NebucadHRO 400. NebucadHRO Lv 1 1 pt. 6,488

Comments