Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 8,397
  2. Avatar for Team China 22. Team China 1 pt. 8,235
  3. Avatar for CHE222 23. CHE222 1 pt. 8,231
  4. Avatar for Czech National Team 24. Czech National Team 1 pt. 8,076
  1. Avatar for felixxy 171. felixxy Lv 1 10 pts. 8,365
  2. Avatar for tonokip 172. tonokip Lv 1 10 pts. 8,364
  3. Avatar for cro0815 173. cro0815 Lv 1 10 pts. 8,364
  4. Avatar for bcre8tvv 174. bcre8tvv Lv 1 10 pts. 8,364
  5. Avatar for Yapp 175. Yapp Lv 1 9 pts. 8,361
  6. Avatar for superteufel 176. superteufel Lv 1 9 pts. 8,359
  7. Avatar for dirkibaerchen 177. dirkibaerchen Lv 1 9 pts. 8,359
  8. Avatar for justjustin 178. justjustin Lv 1 9 pts. 8,354
  9. Avatar for infjamc 179. infjamc Lv 1 9 pts. 8,346
  10. Avatar for pruneau_44 180. pruneau_44 Lv 1 9 pts. 8,346

Comments