Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,246
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 81 pts. 9,221
  3. Avatar for Beta Folders 3. Beta Folders 64 pts. 9,162
  4. Avatar for Go Science 4. Go Science 50 pts. 9,139
  5. Avatar for HMT heritage 5. HMT heritage 39 pts. 9,061
  6. Avatar for Team India 6. Team India 30 pts. 9,055
  7. Avatar for Gargleblasters 7. Gargleblasters 23 pts. 9,025
  8. Avatar for Contenders 8. Contenders 17 pts. 9,024
  9. Avatar for Void Crushers 9. Void Crushers 12 pts. 9,001
  10. Avatar for SETI.Germany 10. SETI.Germany 9 pts. 8,996
  1. Avatar for felixxy 171. felixxy Lv 1 10 pts. 8,365
  2. Avatar for tonokip 172. tonokip Lv 1 10 pts. 8,364
  3. Avatar for cro0815 173. cro0815 Lv 1 10 pts. 8,364
  4. Avatar for bcre8tvv 174. bcre8tvv Lv 1 10 pts. 8,364
  5. Avatar for Yapp 175. Yapp Lv 1 9 pts. 8,361
  6. Avatar for superteufel 176. superteufel Lv 1 9 pts. 8,359
  7. Avatar for dirkibaerchen 177. dirkibaerchen Lv 1 9 pts. 8,359
  8. Avatar for justjustin 178. justjustin Lv 1 9 pts. 8,354
  9. Avatar for infjamc 179. infjamc Lv 1 9 pts. 8,346
  10. Avatar for pruneau_44 180. pruneau_44 Lv 1 9 pts. 8,346

Comments