Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,246
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 81 pts. 9,221
  3. Avatar for Beta Folders 3. Beta Folders 64 pts. 9,162
  4. Avatar for Go Science 4. Go Science 50 pts. 9,139
  5. Avatar for HMT heritage 5. HMT heritage 39 pts. 9,061
  6. Avatar for Team India 6. Team India 30 pts. 9,055
  7. Avatar for Gargleblasters 7. Gargleblasters 23 pts. 9,025
  8. Avatar for Contenders 8. Contenders 17 pts. 9,024
  9. Avatar for Void Crushers 9. Void Crushers 12 pts. 9,001
  10. Avatar for SETI.Germany 10. SETI.Germany 9 pts. 8,996
  1. Avatar for madboew 141. madboew Lv 1 16 pts. 8,480
  2. Avatar for Kaleth.Aran 142. Kaleth.Aran Lv 1 16 pts. 8,474
  3. Avatar for ManVsYard 143. ManVsYard Lv 1 16 pts. 8,473
  4. Avatar for KateMidwife 144. KateMidwife Lv 1 16 pts. 8,469
  5. Avatar for gldisater 145. gldisater Lv 1 15 pts. 8,465
  6. Avatar for gomibako 146. gomibako Lv 1 15 pts. 8,460
  7. Avatar for kingphil 147. kingphil Lv 1 15 pts. 8,459
  8. Avatar for Frutchy 148. Frutchy Lv 1 15 pts. 8,457
  9. Avatar for Evica 149. Evica Lv 1 14 pts. 8,456
  10. Avatar for rinze 150. rinze Lv 1 14 pts. 8,455

Comments