Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,246
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 81 pts. 9,221
  3. Avatar for Beta Folders 3. Beta Folders 64 pts. 9,162
  4. Avatar for Go Science 4. Go Science 50 pts. 9,139
  5. Avatar for HMT heritage 5. HMT heritage 39 pts. 9,061
  6. Avatar for Team India 6. Team India 30 pts. 9,055
  7. Avatar for Gargleblasters 7. Gargleblasters 23 pts. 9,025
  8. Avatar for Contenders 8. Contenders 17 pts. 9,024
  9. Avatar for Void Crushers 9. Void Crushers 12 pts. 9,001
  10. Avatar for SETI.Germany 10. SETI.Germany 9 pts. 8,996
  1. Avatar for Feuerengel 221. Feuerengel Lv 1 4 pts. 8,220
  2. Avatar for bergie72 222. bergie72 Lv 1 4 pts. 8,218
  3. Avatar for Balkendonner60 223. Balkendonner60 Lv 1 4 pts. 8,208
  4. Avatar for tomas-pecserke 224. tomas-pecserke Lv 1 4 pts. 8,207
  5. Avatar for Strawberry7 225. Strawberry7 Lv 1 4 pts. 8,206
  6. Avatar for nspc 226. nspc Lv 1 4 pts. 8,206
  7. Avatar for Comcat79 227. Comcat79 Lv 1 4 pts. 8,199
  8. Avatar for nmp768 228. nmp768 Lv 1 4 pts. 8,198
  9. Avatar for Spacetime02 229. Spacetime02 Lv 1 4 pts. 8,198
  10. Avatar for Schrotty78 230. Schrotty78 Lv 1 4 pts. 8,196

Comments