Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,246
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 81 pts. 9,221
  3. Avatar for Beta Folders 3. Beta Folders 64 pts. 9,162
  4. Avatar for Go Science 4. Go Science 50 pts. 9,139
  5. Avatar for HMT heritage 5. HMT heritage 39 pts. 9,061
  6. Avatar for Team India 6. Team India 30 pts. 9,055
  7. Avatar for Gargleblasters 7. Gargleblasters 23 pts. 9,025
  8. Avatar for Contenders 8. Contenders 17 pts. 9,024
  9. Avatar for Void Crushers 9. Void Crushers 12 pts. 9,001
  10. Avatar for SETI.Germany 10. SETI.Germany 9 pts. 8,996
  1. Avatar for sudochmod 211. sudochmod Lv 1 5 pts. 8,239
  2. Avatar for Sost 212. Sost Lv 1 5 pts. 8,239
  3. Avatar for jimweng 213. jimweng Lv 1 5 pts. 8,235
  4. Avatar for GanjaGaara 214. GanjaGaara Lv 1 5 pts. 8,234
  5. Avatar for wolF777 215. wolF777 Lv 1 5 pts. 8,232
  6. Avatar for esinaydemir 216. esinaydemir Lv 1 5 pts. 8,231
  7. Avatar for BenGraf 217. BenGraf Lv 1 4 pts. 8,230
  8. Avatar for vinc3nt79 218. vinc3nt79 Lv 1 4 pts. 8,229
  9. Avatar for darixchel 219. darixchel Lv 1 4 pts. 8,224
  10. Avatar for vashti0217 220. vashti0217 Lv 1 4 pts. 8,223

Comments