Placeholder image of a protein
Icon representing a puzzle

1819: Revisiting Puzzle 110: Turkey

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
April 01, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Marvin's bunch 11. Marvin's bunch 9 pts. 10,135
  2. Avatar for Penny-Arcade 12. Penny-Arcade 7 pts. 10,068
  3. Avatar for Hold My Beer 13. Hold My Beer 5 pts. 10,063
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 4 pts. 10,049
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 3 pts. 9,875
  6. Avatar for Trinity Biology 16. Trinity Biology 2 pts. 9,835
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 9,726
  8. Avatar for CHNO Junkies 18. CHNO Junkies 1 pt. 9,492
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,860
  10. Avatar for Mojo Risin' 20. Mojo Risin' 1 pt. 8,758

  1. Avatar for obbo 171. obbo Lv 1 4 pts. 9,167
  2. Avatar for chilifish 172. chilifish Lv 1 4 pts. 9,151
  3. Avatar for Raspberry0987 173. Raspberry0987 Lv 1 4 pts. 9,149
  4. Avatar for Ertonier 174. Ertonier Lv 1 4 pts. 9,131
  5. Avatar for RiaSkies 175. RiaSkies Lv 1 4 pts. 9,120
  6. Avatar for kathy65 176. kathy65 Lv 1 4 pts. 9,116
  7. Avatar for WittiWittmann 177. WittiWittmann Lv 1 4 pts. 9,097
  8. Avatar for Strawberry7 178. Strawberry7 Lv 1 4 pts. 9,086
  9. Avatar for bcre8tvv 179. bcre8tvv Lv 1 3 pts. 9,085
  10. Avatar for klc58 180. klc58 Lv 1 3 pts. 9,074

Comments


O Seki To Lv 1

Shouldn't the coronavirus puzzles be changed to all hands, as I suggested a week ago?
This one is quite meaningless, no reason for a joint effort to solve it.
Unless this is the cure for COVID-19…