Placeholder image of a protein
Icon representing a puzzle

1822: Revisiting Puzzle 111: Mouse

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 8 pts. 9,630
  2. Avatar for Team China 12. Team China 6 pts. 9,605
  3. Avatar for Penny-Arcade 13. Penny-Arcade 4 pts. 9,545
  4. Avatar for BOINC@Poland 14. BOINC@Poland 3 pts. 9,531
  5. Avatar for CHNO Junkies 15. CHNO Junkies 2 pts. 9,491
  6. Avatar for Rechenkraft.net 16. Rechenkraft.net 2 pts. 9,470
  7. Avatar for HMT heritage 17. HMT heritage 1 pt. 9,466
  8. Avatar for Trinity Biology 18. Trinity Biology 1 pt. 9,397
  9. Avatar for NMHU Biol4230 Spr 20 19. NMHU Biol4230 Spr 20 1 pt. 9,220
  10. Avatar for Richard Dawkins Foundation 20. Richard Dawkins Foundation 1 pt. 9,183
  1. Avatar for edpalas 121. edpalas Lv 1 10 pts. 9,374
  2. Avatar for 181818 122. 181818 Lv 1 10 pts. 9,374
  3. Avatar for teftatene 123. teftatene Lv 1 10 pts. 9,368
  4. Avatar for tobu2 124. tobu2 Lv 1 10 pts. 9,363
  5. Avatar for dfonda 125. dfonda Lv 1 10 pts. 9,362
  6. Avatar for firejuggler 126. firejuggler Lv 1 9 pts. 9,360
  7. Avatar for KroZZ 127. KroZZ Lv 1 9 pts. 9,358
  8. Avatar for drjr 128. drjr Lv 1 9 pts. 9,358
  9. Avatar for ZiiONIC 129. ZiiONIC Lv 1 9 pts. 9,353
  10. Avatar for Merf 130. Merf Lv 1 8 pts. 9,348

Comments

Serca Lv 1

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ