Placeholder image of a protein
Icon representing a puzzle

1822: Revisiting Puzzle 111: Mouse

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 8 pts. 9,630
  2. Avatar for Team China 12. Team China 6 pts. 9,605
  3. Avatar for Penny-Arcade 13. Penny-Arcade 4 pts. 9,545
  4. Avatar for BOINC@Poland 14. BOINC@Poland 3 pts. 9,531
  5. Avatar for CHNO Junkies 15. CHNO Junkies 2 pts. 9,491
  6. Avatar for Rechenkraft.net 16. Rechenkraft.net 2 pts. 9,470
  7. Avatar for HMT heritage 17. HMT heritage 1 pt. 9,466
  8. Avatar for Trinity Biology 18. Trinity Biology 1 pt. 9,397
  9. Avatar for NMHU Biol4230 Spr 20 19. NMHU Biol4230 Spr 20 1 pt. 9,220
  10. Avatar for Richard Dawkins Foundation 20. Richard Dawkins Foundation 1 pt. 9,183
  1. Avatar for matpiv 281. matpiv Lv 1 1 pt. 8,245
  2. Avatar for Virenex 282. Virenex Lv 1 1 pt. 8,229
  3. Avatar for fjkjoseph 283. fjkjoseph Lv 1 1 pt. 8,168
  4. Avatar for JacoboHernandez17 284. JacoboHernandez17 Lv 1 1 pt. 8,161
  5. Avatar for txyre 285. txyre Lv 1 1 pt. 8,160
  6. Avatar for dabro 286. dabro Lv 1 1 pt. 8,149
  7. Avatar for Edwardinsnow 287. Edwardinsnow Lv 1 1 pt. 8,146
  8. Avatar for 01010011111 288. 01010011111 Lv 1 1 pt. 8,108
  9. Avatar for aminoa_12 289. aminoa_12 Lv 1 1 pt. 8,104
  10. Avatar for Dietel 290. Dietel Lv 1 1 pt. 8,030

Comments

Serca Lv 1

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ