Placeholder image of a protein
Icon representing a puzzle

1822: Revisiting Puzzle 111: Mouse

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 8 pts. 9,630
  2. Avatar for Team China 12. Team China 6 pts. 9,605
  3. Avatar for Penny-Arcade 13. Penny-Arcade 4 pts. 9,545
  4. Avatar for BOINC@Poland 14. BOINC@Poland 3 pts. 9,531
  5. Avatar for CHNO Junkies 15. CHNO Junkies 2 pts. 9,491
  6. Avatar for Rechenkraft.net 16. Rechenkraft.net 2 pts. 9,470
  7. Avatar for HMT heritage 17. HMT heritage 1 pt. 9,466
  8. Avatar for Trinity Biology 18. Trinity Biology 1 pt. 9,397
  9. Avatar for NMHU Biol4230 Spr 20 19. NMHU Biol4230 Spr 20 1 pt. 9,220
  10. Avatar for Richard Dawkins Foundation 20. Richard Dawkins Foundation 1 pt. 9,183
  1. Avatar for n41722109 311. n41722109 Lv 1 1 pt. 5,020
  2. Avatar for puxatudo 312. puxatudo Lv 1 1 pt. 5,020
  3. Avatar for Alexander_Fleming 313. Alexander_Fleming Lv 1 1 pt. 5,020
  4. Avatar for sweetian 314. sweetian Lv 1 1 pt. 5,020
  5. Avatar for ichwilldiesennamen 315. ichwilldiesennamen Lv 1 1 pt. 5,020
  6. Avatar for Bletchley Park 316. Bletchley Park Lv 1 1 pt. 5,020
  7. Avatar for DerAndre1310 317. DerAndre1310 Lv 1 1 pt. 5,020
  8. Avatar for Tony_Jin 318. Tony_Jin Lv 1 1 pt. 5,020
  9. Avatar for loomis343 319. loomis343 Lv 1 1 pt. 5,020
  10. Avatar for precieux degoute 320. precieux degoute Lv 1 1 pt. 5,020

Comments

Serca Lv 1

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ