Placeholder image of a protein
Icon representing a puzzle

1822: Revisiting Puzzle 111: Mouse

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 8 pts. 9,630
  2. Avatar for Team China 12. Team China 6 pts. 9,605
  3. Avatar for Penny-Arcade 13. Penny-Arcade 4 pts. 9,545
  4. Avatar for BOINC@Poland 14. BOINC@Poland 3 pts. 9,531
  5. Avatar for CHNO Junkies 15. CHNO Junkies 2 pts. 9,491
  6. Avatar for Rechenkraft.net 16. Rechenkraft.net 2 pts. 9,470
  7. Avatar for HMT heritage 17. HMT heritage 1 pt. 9,466
  8. Avatar for Trinity Biology 18. Trinity Biology 1 pt. 9,397
  9. Avatar for NMHU Biol4230 Spr 20 19. NMHU Biol4230 Spr 20 1 pt. 9,220

  1. Avatar for Timo van der Laan 31. Timo van der Laan Lv 1 62 pts. 9,683
  2. Avatar for g_b 32. g_b Lv 1 61 pts. 9,683
  3. Avatar for johnmitch 33. johnmitch Lv 1 60 pts. 9,681
  4. Avatar for Steven Pletsch 34. Steven Pletsch Lv 1 59 pts. 9,674
  5. Avatar for tangofox10 35. tangofox10 Lv 1 58 pts. 9,665
  6. Avatar for Pan Frank 36. Pan Frank Lv 1 57 pts. 9,660
  7. Avatar for MrZanav 37. MrZanav Lv 1 56 pts. 9,659
  8. Avatar for RyeSnake 38. RyeSnake Lv 1 55 pts. 9,653
  9. Avatar for steveB 39. steveB Lv 1 54 pts. 9,652
  10. Avatar for nicobul 40. nicobul Lv 1 53 pts. 9,648

Comments


Serca Lv 1

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ