Placeholder image of a protein
Icon representing a puzzle

1822: Revisiting Puzzle 111: Mouse

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for ICSP HAP 2020 21. ICSP HAP 2020 1 pt. 9,151
  2. Avatar for Mojo Risin' 22. Mojo Risin' 1 pt. 8,982
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,496
  4. Avatar for Window Group 24. Window Group 1 pt. 5,020
  5. Avatar for BIOC 402 25. BIOC 402 1 pt. 5,020
  6. Avatar for Dr. B Orgo 2 26. Dr. B Orgo 2 1 pt. 5,020
  1. Avatar for donuts554 171. donuts554 Lv 1 3 pts. 9,219
  2. Avatar for yippee 172. yippee Lv 1 3 pts. 9,216
  3. Avatar for w1seguy 173. w1seguy Lv 1 3 pts. 9,215
  4. Avatar for Owens24 174. Owens24 Lv 1 3 pts. 9,215
  5. Avatar for foldthestuffman 175. foldthestuffman Lv 1 3 pts. 9,215
  6. Avatar for lraguette 176. lraguette Lv 1 3 pts. 9,215
  7. Avatar for JAucitel 177. JAucitel Lv 1 3 pts. 9,209
  8. Avatar for spdenne 178. spdenne Lv 1 2 pts. 9,208
  9. Avatar for cyberman500 179. cyberman500 Lv 1 2 pts. 9,207
  10. Avatar for jojo2525 180. jojo2525 Lv 1 2 pts. 9,205

Comments

Serca Lv 1

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ